PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_018624-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 364aa    MW: 40115 Da    PI: 5.3335
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_018624-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.2e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+ l++ +++ G g+W++ ++  g++R++k+c++rw +yl
    NNU_018624-RA 15 KGPWTPEEDQMLIEFIQKNGHGSWRALPSLAGLNRCGKSCRLRWTNYL 62
                     79********************************************97 PP

2Myb_DNA-binding56.27.7e-1868113148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE+++++d++  lG++ W++Ia++++ gRt++++k++w+++l
    NNU_018624-RA  68 RGKFSDEEEKIIIDLHSVLGNK-WSAIASHLP-GRTDNEIKNFWNTHL 113
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-24665IPR009057Homeodomain-like
PROSITE profilePS5129417.3311062IPR017930Myb domain
SuperFamilySSF466893.59E-3112109IPR009057Homeodomain-like
SMARTSM007178.8E-151464IPR001005SANT/Myb domain
PfamPF002492.4E-161562IPR001005SANT/Myb domain
CDDcd001672.06E-111762No hitNo description
PROSITE profilePS5129426.76363117IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2766117IPR009057Homeodomain-like
SMARTSM007175.4E-1767115IPR001005SANT/Myb domain
PfamPF002493.1E-1668113IPR001005SANT/Myb domain
CDDcd001675.97E-1370113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MMGRSPCCDE SGLKKGPWTP EEDQMLIEFI QKNGHGSWRA LPSLAGLNRC GKSCRLRWTN  60
YLRPDIKRGK FSDEEEKIII DLHSVLGNKW SAIASHLPGR TDNEIKNFWN THLRKKLLNM  120
GIDPVTHRPR TDLNLLANLP QLLAITSLNN LMHPLDALRL QAEAAQLARN QLLQNLLQAV  180
NGSTPPNLGA VLNLQGSSSP NQGYNPAEYP QPNTQLEGLV NNNLQAQALP TANPLAPALH  240
HAHQMSTNFA NSGVIQQPSN DGLIPENSAY FGGVCSTLIN NEYVNNISNN NLNSSDGIEQ  300
MPPLVSASPE MEEMKPHTNI CDPPSTSTTF DTWGELNLDD DGSDYWGDML EYVPHFSSLS  360
PSIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-31131175108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010274278.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP02e-76MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A061EYD81e-117A0A061EYD8_THECC; Myb domain protein 107
STRINGVIT_16s0039g01710.t011e-114(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.17e-82myb domain protein 93